Anti RCL1 pAb (ATL-HPA071308)

Atlas Antibodies

Catalog No.:
ATL-HPA071308-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RNA terminal phosphate cyclase-like 1
Gene Name: RCL1
Alternative Gene Name: RNAC, RPCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024785: 96%, ENSRNOG00000015491: 96%
Entrez Gene ID: 10171
Uniprot ID: Q9Y2P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGK
Gene Sequence RGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGK
Gene ID - Mouse ENSMUSG00000024785
Gene ID - Rat ENSRNOG00000015491
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RCL1 pAb (ATL-HPA071308)
Datasheet Anti RCL1 pAb (ATL-HPA071308) Datasheet (External Link)
Vendor Page Anti RCL1 pAb (ATL-HPA071308) at Atlas Antibodies

Documents & Links for Anti RCL1 pAb (ATL-HPA071308)
Datasheet Anti RCL1 pAb (ATL-HPA071308) Datasheet (External Link)
Vendor Page Anti RCL1 pAb (ATL-HPA071308)