Anti RCL1 pAb (ATL-HPA071308)

Atlas Antibodies

SKU: ATL-HPA071308-25

• 

Protein Description: RNA terminal phosphate cyclase-like 1
Gene Name: RCL1
Alternative Gene Name: RNAC, RPCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024785: 96%, ENSRNOG00000015491: 96%
Entrez Gene ID: 10171
Uniprot ID: Q9Y2P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGK
• Gene Sequence: RGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGK
• Gene ID - Mouse: ENSMUSG00000024785
• Gene ID - Rat: ENSRNOG00000015491
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.