Anti RCC2 pAb (ATL-HPA072281)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072281-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RCC2
Alternative Gene Name: TD-60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040945: 93%, ENSRNOG00000006327: 92%
Entrez Gene ID: 55920
Uniprot ID: Q9P258
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN |
| Gene Sequence | ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN |
| Gene ID - Mouse | ENSMUSG00000040945 |
| Gene ID - Rat | ENSRNOG00000006327 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RCC2 pAb (ATL-HPA072281) | |
| Datasheet | Anti RCC2 pAb (ATL-HPA072281) Datasheet (External Link) |
| Vendor Page | Anti RCC2 pAb (ATL-HPA072281) at Atlas Antibodies |
| Documents & Links for Anti RCC2 pAb (ATL-HPA072281) | |
| Datasheet | Anti RCC2 pAb (ATL-HPA072281) Datasheet (External Link) |
| Vendor Page | Anti RCC2 pAb (ATL-HPA072281) |