Anti RCC2 pAb (ATL-HPA072281)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072281-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RCC2
Alternative Gene Name: TD-60
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040945: 93%, ENSRNOG00000006327: 92%
Entrez Gene ID: 55920
Uniprot ID: Q9P258
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN |
Gene Sequence | ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN |
Gene ID - Mouse | ENSMUSG00000040945 |
Gene ID - Rat | ENSRNOG00000006327 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RCC2 pAb (ATL-HPA072281) | |
Datasheet | Anti RCC2 pAb (ATL-HPA072281) Datasheet (External Link) |
Vendor Page | Anti RCC2 pAb (ATL-HPA072281) at Atlas Antibodies |
Documents & Links for Anti RCC2 pAb (ATL-HPA072281) | |
Datasheet | Anti RCC2 pAb (ATL-HPA072281) Datasheet (External Link) |
Vendor Page | Anti RCC2 pAb (ATL-HPA072281) |