Anti RCC1L pAb (ATL-HPA060643)

Atlas Antibodies

Catalog No.:
ATL-HPA060643-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RCC1 like
Gene Name: RCC1L
Alternative Gene Name: WBSCR16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061979: 95%, ENSRNOG00000001483: 94%
Entrez Gene ID: 81554
Uniprot ID: Q96I51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVEN
Gene Sequence TLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVEN
Gene ID - Mouse ENSMUSG00000061979
Gene ID - Rat ENSRNOG00000001483
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RCC1L pAb (ATL-HPA060643)
Datasheet Anti RCC1L pAb (ATL-HPA060643) Datasheet (External Link)
Vendor Page Anti RCC1L pAb (ATL-HPA060643) at Atlas Antibodies

Documents & Links for Anti RCC1L pAb (ATL-HPA060643)
Datasheet Anti RCC1L pAb (ATL-HPA060643) Datasheet (External Link)
Vendor Page Anti RCC1L pAb (ATL-HPA060643)