Anti RCBTB1 pAb (ATL-HPA056783)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056783-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RCBTB1
Alternative Gene Name: CLLD7, CLLL7, FLJ10716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035469: 100%, ENSRNOG00000021712: 100%
Entrez Gene ID: 55213
Uniprot ID: Q8NDN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY |
Gene Sequence | RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY |
Gene ID - Mouse | ENSMUSG00000035469 |
Gene ID - Rat | ENSRNOG00000021712 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RCBTB1 pAb (ATL-HPA056783) | |
Datasheet | Anti RCBTB1 pAb (ATL-HPA056783) Datasheet (External Link) |
Vendor Page | Anti RCBTB1 pAb (ATL-HPA056783) at Atlas Antibodies |
Documents & Links for Anti RCBTB1 pAb (ATL-HPA056783) | |
Datasheet | Anti RCBTB1 pAb (ATL-HPA056783) Datasheet (External Link) |
Vendor Page | Anti RCBTB1 pAb (ATL-HPA056783) |