Anti RCBTB1 pAb (ATL-HPA056783)

Atlas Antibodies

Catalog No.: ATL-HPA056783-25

Protein Description: regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
Gene Name: RCBTB1
Alternative Gene Name: CLLD7, CLLL7, FLJ10716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035469: 100%, ENSRNOG00000021712: 100%
Entrez Gene ID: 55213
Uniprot ID: Q8NDN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY
• Gene Sequence: RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY
• Gene ID - Mouse: ENSMUSG00000035469
• Gene ID - Rat: ENSRNOG00000021712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.