Anti RCBTB1 pAb (ATL-HPA056783)

Atlas Antibodies

Catalog No.:
ATL-HPA056783-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1
Gene Name: RCBTB1
Alternative Gene Name: CLLD7, CLLL7, FLJ10716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035469: 100%, ENSRNOG00000021712: 100%
Entrez Gene ID: 55213
Uniprot ID: Q8NDN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY
Gene Sequence RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY
Gene ID - Mouse ENSMUSG00000035469
Gene ID - Rat ENSRNOG00000021712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RCBTB1 pAb (ATL-HPA056783)
Datasheet Anti RCBTB1 pAb (ATL-HPA056783) Datasheet (External Link)
Vendor Page Anti RCBTB1 pAb (ATL-HPA056783) at Atlas Antibodies

Documents & Links for Anti RCBTB1 pAb (ATL-HPA056783)
Datasheet Anti RCBTB1 pAb (ATL-HPA056783) Datasheet (External Link)
Vendor Page Anti RCBTB1 pAb (ATL-HPA056783)