Anti RC3H2 pAb (ATL-HPA062144)

Atlas Antibodies

Catalog No.:
ATL-HPA062144-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger and CCCH-type domains 2
Gene Name: RC3H2
Alternative Gene Name: FLJ20301, FLJ20713, MNAB, RNF164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075376: 88%, ENSRNOG00000009196: 89%
Entrez Gene ID: 54542
Uniprot ID: Q9HBD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV
Gene Sequence QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV
Gene ID - Mouse ENSMUSG00000075376
Gene ID - Rat ENSRNOG00000009196
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RC3H2 pAb (ATL-HPA062144)
Datasheet Anti RC3H2 pAb (ATL-HPA062144) Datasheet (External Link)
Vendor Page Anti RC3H2 pAb (ATL-HPA062144) at Atlas Antibodies

Documents & Links for Anti RC3H2 pAb (ATL-HPA062144)
Datasheet Anti RC3H2 pAb (ATL-HPA062144) Datasheet (External Link)
Vendor Page Anti RC3H2 pAb (ATL-HPA062144)