Anti RC3H2 pAb (ATL-HPA062144)

Atlas Antibodies

Catalog No.: ATL-HPA062144-25

Protein Description: ring finger and CCCH-type domains 2
Gene Name: RC3H2
Alternative Gene Name: FLJ20301, FLJ20713, MNAB, RNF164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075376: 88%, ENSRNOG00000009196: 89%
Entrez Gene ID: 54542
Uniprot ID: Q9HBD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV
• Gene Sequence: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV
• Gene ID - Mouse: ENSMUSG00000075376
• Gene ID - Rat: ENSRNOG00000009196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.