Anti RC3H2 pAb (ATL-HPA062144)
Atlas Antibodies
- SKU:
- ATL-HPA062144-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RC3H2
Alternative Gene Name: FLJ20301, FLJ20713, MNAB, RNF164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075376: 88%, ENSRNOG00000009196: 89%
Entrez Gene ID: 54542
Uniprot ID: Q9HBD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV |
Gene Sequence | QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV |
Gene ID - Mouse | ENSMUSG00000075376 |
Gene ID - Rat | ENSRNOG00000009196 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RC3H2 pAb (ATL-HPA062144) | |
Datasheet | Anti RC3H2 pAb (ATL-HPA062144) Datasheet (External Link) |
Vendor Page | Anti RC3H2 pAb (ATL-HPA062144) at Atlas Antibodies |
Documents & Links for Anti RC3H2 pAb (ATL-HPA062144) | |
Datasheet | Anti RC3H2 pAb (ATL-HPA062144) Datasheet (External Link) |
Vendor Page | Anti RC3H2 pAb (ATL-HPA062144) |