Anti RBMY1A1 pAb (ATL-HPA001534)

Atlas Antibodies

Catalog No.:
ATL-HPA001534-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein, Y-linked, family 1, member A1
Gene Name: RBMY1A1
Alternative Gene Name: RBM1, RBM2, YRRM1, YRRM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031134: 73%, ENSRNOG00000000866: 73%
Entrez Gene ID: 5940
Uniprot ID: P0DJD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGW
Gene Sequence MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGW
Gene ID - Mouse ENSMUSG00000031134
Gene ID - Rat ENSRNOG00000000866
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBMY1A1 pAb (ATL-HPA001534)
Datasheet Anti RBMY1A1 pAb (ATL-HPA001534) Datasheet (External Link)
Vendor Page Anti RBMY1A1 pAb (ATL-HPA001534) at Atlas Antibodies

Documents & Links for Anti RBMY1A1 pAb (ATL-HPA001534)
Datasheet Anti RBMY1A1 pAb (ATL-HPA001534) Datasheet (External Link)
Vendor Page Anti RBMY1A1 pAb (ATL-HPA001534)