Anti RBMS2 pAb (ATL-HPA058784)

Atlas Antibodies

SKU: ATL-HPA058784-25

• 

Protein Description: RNA binding motif, single stranded interacting protein 2
Gene Name: RBMS2
Alternative Gene Name: SCR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040043: 57%, ENSRNOG00000003076: 83%
Entrez Gene ID: 5939
Uniprot ID: Q15434
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQ
• Gene Sequence: DPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQ
• Gene ID - Mouse: ENSMUSG00000040043
• Gene ID - Rat: ENSRNOG00000003076
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.