Anti RBMS2 pAb (ATL-HPA058784)

Atlas Antibodies

Catalog No.:
ATL-HPA058784-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RNA binding motif, single stranded interacting protein 2
Gene Name: RBMS2
Alternative Gene Name: SCR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040043: 57%, ENSRNOG00000003076: 83%
Entrez Gene ID: 5939
Uniprot ID: Q15434
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQ
Gene Sequence DPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQ
Gene ID - Mouse ENSMUSG00000040043
Gene ID - Rat ENSRNOG00000003076
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBMS2 pAb (ATL-HPA058784)
Datasheet Anti RBMS2 pAb (ATL-HPA058784) Datasheet (External Link)
Vendor Page Anti RBMS2 pAb (ATL-HPA058784) at Atlas Antibodies

Documents & Links for Anti RBMS2 pAb (ATL-HPA058784)
Datasheet Anti RBMS2 pAb (ATL-HPA058784) Datasheet (External Link)
Vendor Page Anti RBMS2 pAb (ATL-HPA058784)