Anti RBMS1 pAb (ATL-HPA061791)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061791-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: RBMS1
Alternative Gene Name: C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026970: 100%, ENSRNOG00000008482: 100%
Entrez Gene ID: 5937
Uniprot ID: P29558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP |
| Gene Sequence | QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP |
| Gene ID - Mouse | ENSMUSG00000026970 |
| Gene ID - Rat | ENSRNOG00000008482 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RBMS1 pAb (ATL-HPA061791) | |
| Datasheet | Anti RBMS1 pAb (ATL-HPA061791) Datasheet (External Link) |
| Vendor Page | Anti RBMS1 pAb (ATL-HPA061791) at Atlas Antibodies |
| Documents & Links for Anti RBMS1 pAb (ATL-HPA061791) | |
| Datasheet | Anti RBMS1 pAb (ATL-HPA061791) Datasheet (External Link) |
| Vendor Page | Anti RBMS1 pAb (ATL-HPA061791) |