Anti RBM5 pAb (ATL-HPA017335)

Atlas Antibodies

Catalog No.: ATL-HPA017335-25

Protein Description: RNA binding motif protein 5
Gene Name: RBM5
Alternative Gene Name: H37, LUCA15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032580: 95%, ENSRNOG00000018153: 94%
Entrez Gene ID: 10181
Uniprot ID: P52756
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYY
• Gene Sequence: WSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYY
• Gene ID - Mouse: ENSMUSG00000032580
• Gene ID - Rat: ENSRNOG00000018153
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBM5 pAb (ATL-HPA017335) – 2 Found

Sun, Yue; Bao, Yufang; Han, Wenjian; Song, Fan; Shen, Xianfeng; Zhao, Jiawei; Zuo, Ji; Saffen, David; Chen, Wei; Wang, Zefeng; You, Xintian; Wang, Yongbo. Autoregulation of RBM10 and cross-regulation of RBM10/RBM5 via alternative splicing-coupled nonsense-mediated decay. Nucleic Acids Research. 2017;45(14):8524-8540. 

Pourpre, Renaud; Lakisic, Goran; Desgranges, Emma; Cossart, Pascale; Pagliuso, Alessandro; Bierne, Hélène. A bacterial virulence factor interacts with the splicing factor RBM5 and stimulates formation of nuclear RBM5 granules. Scientific Reports. 2022;12(1):21961.