Anti RBM46 pAb (ATL-HPA079488)

Atlas Antibodies

Catalog No.:
ATL-HPA079488-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 46
Gene Name: RBM46
Alternative Gene Name: CT68, MGC27016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033882: 100%, ENSRNOG00000025823: 100%
Entrez Gene ID: 166863
Uniprot ID: Q8TBY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNSAVMHLDYYCNKNNWAPPEYYLYSTTSQDGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKELAA
Gene Sequence FNSAVMHLDYYCNKNNWAPPEYYLYSTTSQDGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKELAA
Gene ID - Mouse ENSMUSG00000033882
Gene ID - Rat ENSRNOG00000025823
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM46 pAb (ATL-HPA079488)
Datasheet Anti RBM46 pAb (ATL-HPA079488) Datasheet (External Link)
Vendor Page Anti RBM46 pAb (ATL-HPA079488) at Atlas Antibodies

Documents & Links for Anti RBM46 pAb (ATL-HPA079488)
Datasheet Anti RBM46 pAb (ATL-HPA079488) Datasheet (External Link)
Vendor Page Anti RBM46 pAb (ATL-HPA079488)