Anti RBM46 pAb (ATL-HPA079488)

Atlas Antibodies

Catalog No.: ATL-HPA079488-25

Protein Description: RNA binding motif protein 46
Gene Name: RBM46
Alternative Gene Name: CT68, MGC27016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033882: 100%, ENSRNOG00000025823: 100%
Entrez Gene ID: 166863
Uniprot ID: Q8TBY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FNSAVMHLDYYCNKNNWAPPEYYLYSTTSQDGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKELAA
• Gene Sequence: FNSAVMHLDYYCNKNNWAPPEYYLYSTTSQDGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKELAA
• Gene ID - Mouse: ENSMUSG00000033882
• Gene ID - Rat: ENSRNOG00000025823
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.