Anti RBM28 pAb (ATL-HPA031519)

Atlas Antibodies

Catalog No.:
ATL-HPA031519-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 28
Gene Name: RBM28
Alternative Gene Name: FLJ10377
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029701: 59%, ENSRNOG00000005468: 60%
Entrez Gene ID: 55131
Uniprot ID: Q9NW13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENDDDDDDDDEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKSSDHSEEDSDLEESDSIDDGEELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEE
Gene Sequence ENDDDDDDDDEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKSSDHSEEDSDLEESDSIDDGEELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEE
Gene ID - Mouse ENSMUSG00000029701
Gene ID - Rat ENSRNOG00000005468
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM28 pAb (ATL-HPA031519)
Datasheet Anti RBM28 pAb (ATL-HPA031519) Datasheet (External Link)
Vendor Page Anti RBM28 pAb (ATL-HPA031519) at Atlas Antibodies

Documents & Links for Anti RBM28 pAb (ATL-HPA031519)
Datasheet Anti RBM28 pAb (ATL-HPA031519) Datasheet (External Link)
Vendor Page Anti RBM28 pAb (ATL-HPA031519)