Anti RBM25 pAb (ATL-HPA070713)

Atlas Antibodies

SKU: ATL-HPA070713-25

• 

Protein Description: RNA binding motif protein 25
Gene Name: RBM25
Alternative Gene Name: fSAP94, NET52, RNPC7, S164, Snu71
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010608: 99%, ENSRNOG00000002871: 99%
Entrez Gene ID: 58517
Uniprot ID: P49756
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW
• Gene Sequence: FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW
• Gene ID - Mouse: ENSMUSG00000010608
• Gene ID - Rat: ENSRNOG00000002871
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RBM25 pAb (ATL-HPA070713) – 1 Found

Ilik, İbrahim Avşar; Malszycki, Michal; Lübke, Anna Katharina; Schade, Claudia; Meierhofer, David; Aktaş, Tuğçe. SON and SRRM2 are essential for nuclear speckle formation. Elife. 2020;9( 33095160)