Anti RBM25 pAb (ATL-HPA070713)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070713-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RBM25
Alternative Gene Name: fSAP94, NET52, RNPC7, S164, Snu71
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010608: 99%, ENSRNOG00000002871: 99%
Entrez Gene ID: 58517
Uniprot ID: P49756
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW |
| Gene Sequence | FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW |
| Gene ID - Mouse | ENSMUSG00000010608 |
| Gene ID - Rat | ENSRNOG00000002871 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RBM25 pAb (ATL-HPA070713) | |
| Datasheet | Anti RBM25 pAb (ATL-HPA070713) Datasheet (External Link) |
| Vendor Page | Anti RBM25 pAb (ATL-HPA070713) at Atlas Antibodies |
| Documents & Links for Anti RBM25 pAb (ATL-HPA070713) | |
| Datasheet | Anti RBM25 pAb (ATL-HPA070713) Datasheet (External Link) |
| Vendor Page | Anti RBM25 pAb (ATL-HPA070713) |
| Citations for Anti RBM25 pAb (ATL-HPA070713) – 1 Found |
| Ilik, İbrahim Avşar; Malszycki, Michal; Lübke, Anna Katharina; Schade, Claudia; Meierhofer, David; Aktaş, Tuğçe. SON and SRRM2 are essential for nuclear speckle formation. Elife. 2020;9( 33095160) PubMed |