Anti RBM25 pAb (ATL-HPA070713)
Atlas Antibodies
- SKU:
- ATL-HPA070713-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RBM25
Alternative Gene Name: fSAP94, NET52, RNPC7, S164, Snu71
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010608: 99%, ENSRNOG00000002871: 99%
Entrez Gene ID: 58517
Uniprot ID: P49756
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW |
Gene Sequence | FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW |
Gene ID - Mouse | ENSMUSG00000010608 |
Gene ID - Rat | ENSRNOG00000002871 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RBM25 pAb (ATL-HPA070713) | |
Datasheet | Anti RBM25 pAb (ATL-HPA070713) Datasheet (External Link) |
Vendor Page | Anti RBM25 pAb (ATL-HPA070713) at Atlas Antibodies |
Documents & Links for Anti RBM25 pAb (ATL-HPA070713) | |
Datasheet | Anti RBM25 pAb (ATL-HPA070713) Datasheet (External Link) |
Vendor Page | Anti RBM25 pAb (ATL-HPA070713) |
Citations for Anti RBM25 pAb (ATL-HPA070713) – 1 Found |
Ilik, İbrahim Avşar; Malszycki, Michal; Lübke, Anna Katharina; Schade, Claudia; Meierhofer, David; Aktaş, Tuğçe. SON and SRRM2 are essential for nuclear speckle formation. Elife. 2020;9( 33095160) PubMed |