Anti RBM20 pAb (ATL-HPA070358)

Atlas Antibodies

Catalog No.:
ATL-HPA070358-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 20
Gene Name: RBM20
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043639: 77%, ENSRNOG00000014705: 79%
Entrez Gene ID: 282996
Uniprot ID: Q5T481
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYYRKEPKAKSDKYLKQQQDAPGRSRRKDEARLRESRHPHPDDSGKEDGLGPKVTRAPEGAKAKQNEKNKTKRTDRDQEGADD
Gene Sequence GYYRKEPKAKSDKYLKQQQDAPGRSRRKDEARLRESRHPHPDDSGKEDGLGPKVTRAPEGAKAKQNEKNKTKRTDRDQEGADD
Gene ID - Mouse ENSMUSG00000043639
Gene ID - Rat ENSRNOG00000014705
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM20 pAb (ATL-HPA070358)
Datasheet Anti RBM20 pAb (ATL-HPA070358) Datasheet (External Link)
Vendor Page Anti RBM20 pAb (ATL-HPA070358) at Atlas Antibodies

Documents & Links for Anti RBM20 pAb (ATL-HPA070358)
Datasheet Anti RBM20 pAb (ATL-HPA070358) Datasheet (External Link)
Vendor Page Anti RBM20 pAb (ATL-HPA070358)