Anti RBM19 pAb (ATL-HPA058732)

Atlas Antibodies

Catalog No.: ATL-HPA058732-25

Protein Description: RNA binding motif protein 19
Gene Name: RBM19
Alternative Gene Name: DKFZp586F1023, KIAA0682
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029594: 77%, ENSRNOG00000001397: 81%
Entrez Gene ID: 9904
Uniprot ID: Q9Y4C8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGFIGFKSEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQ
• Gene Sequence: FGFIGFKSEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQ
• Gene ID - Mouse: ENSMUSG00000029594
• Gene ID - Rat: ENSRNOG00000001397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.