Anti RBM19 pAb (ATL-HPA058732)

Atlas Antibodies

Catalog No.:
ATL-HPA058732-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 19
Gene Name: RBM19
Alternative Gene Name: DKFZp586F1023, KIAA0682
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029594: 77%, ENSRNOG00000001397: 81%
Entrez Gene ID: 9904
Uniprot ID: Q9Y4C8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGFIGFKSEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQ
Gene Sequence FGFIGFKSEEEAQKAQKHFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVHQ
Gene ID - Mouse ENSMUSG00000029594
Gene ID - Rat ENSRNOG00000001397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM19 pAb (ATL-HPA058732)
Datasheet Anti RBM19 pAb (ATL-HPA058732) Datasheet (External Link)
Vendor Page Anti RBM19 pAb (ATL-HPA058732) at Atlas Antibodies

Documents & Links for Anti RBM19 pAb (ATL-HPA058732)
Datasheet Anti RBM19 pAb (ATL-HPA058732) Datasheet (External Link)
Vendor Page Anti RBM19 pAb (ATL-HPA058732)