Anti RBM18 pAb (ATL-HPA057281)

Atlas Antibodies

Catalog No.: ATL-HPA057281-25

Protein Description: RNA binding motif protein 18
Gene Name: RBM18
Alternative Gene Name: MGC2734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026889: 100%, ENSRNOG00000006763: 99%
Entrez Gene ID: 92400
Uniprot ID: Q96H35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLA
• Gene Sequence: LPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLA
• Gene ID - Mouse: ENSMUSG00000026889
• Gene ID - Rat: ENSRNOG00000006763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.