Anti RBM18 pAb (ATL-HPA057281)

Atlas Antibodies

Catalog No.:
ATL-HPA057281-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 18
Gene Name: RBM18
Alternative Gene Name: MGC2734
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026889: 100%, ENSRNOG00000006763: 99%
Entrez Gene ID: 92400
Uniprot ID: Q96H35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLA
Gene Sequence LPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLA
Gene ID - Mouse ENSMUSG00000026889
Gene ID - Rat ENSRNOG00000006763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM18 pAb (ATL-HPA057281)
Datasheet Anti RBM18 pAb (ATL-HPA057281) Datasheet (External Link)
Vendor Page Anti RBM18 pAb (ATL-HPA057281) at Atlas Antibodies

Documents & Links for Anti RBM18 pAb (ATL-HPA057281)
Datasheet Anti RBM18 pAb (ATL-HPA057281) Datasheet (External Link)
Vendor Page Anti RBM18 pAb (ATL-HPA057281)