Anti RBM15B pAb (ATL-HPA058136)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058136-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RBM15B
Alternative Gene Name: HUMAGCGB, OTT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074102: 99%, ENSRNOG00000014161: 98%
Entrez Gene ID: 29890
Uniprot ID: Q8NDT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRAT |
Gene Sequence | LHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSRERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRAT |
Gene ID - Mouse | ENSMUSG00000074102 |
Gene ID - Rat | ENSRNOG00000014161 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RBM15B pAb (ATL-HPA058136) | |
Datasheet | Anti RBM15B pAb (ATL-HPA058136) Datasheet (External Link) |
Vendor Page | Anti RBM15B pAb (ATL-HPA058136) at Atlas Antibodies |
Documents & Links for Anti RBM15B pAb (ATL-HPA058136) | |
Datasheet | Anti RBM15B pAb (ATL-HPA058136) Datasheet (External Link) |
Vendor Page | Anti RBM15B pAb (ATL-HPA058136) |