Anti RBM12B pAb (ATL-HPA053050)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053050-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RBM12B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052137: 80%, ENSRNOG00000055292: 75%
Entrez Gene ID: 389677
Uniprot ID: Q8IXT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYG |
Gene Sequence | ARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYG |
Gene ID - Mouse | ENSMUSG00000052137 |
Gene ID - Rat | ENSRNOG00000055292 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RBM12B pAb (ATL-HPA053050) | |
Datasheet | Anti RBM12B pAb (ATL-HPA053050) Datasheet (External Link) |
Vendor Page | Anti RBM12B pAb (ATL-HPA053050) at Atlas Antibodies |
Documents & Links for Anti RBM12B pAb (ATL-HPA053050) | |
Datasheet | Anti RBM12B pAb (ATL-HPA053050) Datasheet (External Link) |
Vendor Page | Anti RBM12B pAb (ATL-HPA053050) |