Anti RBM12B pAb (ATL-HPA053050)

Atlas Antibodies

Catalog No.:
ATL-HPA053050-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 12B
Gene Name: RBM12B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052137: 80%, ENSRNOG00000055292: 75%
Entrez Gene ID: 389677
Uniprot ID: Q8IXT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYG
Gene Sequence ARRAISRSGGFIKDSSVELFLSSKAEMQKTIEMKRTDRVGRGRPGSGTSGVDSLSNFIESVKEEASNSGYG
Gene ID - Mouse ENSMUSG00000052137
Gene ID - Rat ENSRNOG00000055292
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM12B pAb (ATL-HPA053050)
Datasheet Anti RBM12B pAb (ATL-HPA053050) Datasheet (External Link)
Vendor Page Anti RBM12B pAb (ATL-HPA053050) at Atlas Antibodies

Documents & Links for Anti RBM12B pAb (ATL-HPA053050)
Datasheet Anti RBM12B pAb (ATL-HPA053050) Datasheet (External Link)
Vendor Page Anti RBM12B pAb (ATL-HPA053050)