Anti RBM10 pAb (ATL-HPA057372)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057372-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RBM10
Alternative Gene Name: DXS8237E, GPATC9, GPATCH9, KIAA0122, ZRANB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031060: 98%, ENSRNOG00000008472: 98%
Entrez Gene ID: 8241
Uniprot ID: P98175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHST |
| Gene Sequence | EKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHST |
| Gene ID - Mouse | ENSMUSG00000031060 |
| Gene ID - Rat | ENSRNOG00000008472 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RBM10 pAb (ATL-HPA057372) | |
| Datasheet | Anti RBM10 pAb (ATL-HPA057372) Datasheet (External Link) |
| Vendor Page | Anti RBM10 pAb (ATL-HPA057372) at Atlas Antibodies |
| Documents & Links for Anti RBM10 pAb (ATL-HPA057372) | |
| Datasheet | Anti RBM10 pAb (ATL-HPA057372) Datasheet (External Link) |
| Vendor Page | Anti RBM10 pAb (ATL-HPA057372) |