Anti RBM10 pAb (ATL-HPA057372)

Atlas Antibodies

Catalog No.:
ATL-HPA057372-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RNA binding motif protein 10
Gene Name: RBM10
Alternative Gene Name: DXS8237E, GPATC9, GPATCH9, KIAA0122, ZRANB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031060: 98%, ENSRNOG00000008472: 98%
Entrez Gene ID: 8241
Uniprot ID: P98175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHST
Gene Sequence EKCFKCGVPKSEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILRNLNPHST
Gene ID - Mouse ENSMUSG00000031060
Gene ID - Rat ENSRNOG00000008472
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBM10 pAb (ATL-HPA057372)
Datasheet Anti RBM10 pAb (ATL-HPA057372) Datasheet (External Link)
Vendor Page Anti RBM10 pAb (ATL-HPA057372) at Atlas Antibodies

Documents & Links for Anti RBM10 pAb (ATL-HPA057372)
Datasheet Anti RBM10 pAb (ATL-HPA057372) Datasheet (External Link)
Vendor Page Anti RBM10 pAb (ATL-HPA057372)