Anti RBFOX3 pAb (ATL-HPA075862)

Atlas Antibodies

Catalog No.:
ATL-HPA075862-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RNA binding fox-1 homolog 3
Gene Name: RBFOX3
Alternative Gene Name: FOX-3, HRNBP3, NeuN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008658: 100%, ENSRNOG00000003386: 100%
Entrez Gene ID: 146713
Uniprot ID: A6NFN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS
Gene Sequence SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS
Gene ID - Mouse ENSMUSG00000008658
Gene ID - Rat ENSRNOG00000003386
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBFOX3 pAb (ATL-HPA075862)
Datasheet Anti RBFOX3 pAb (ATL-HPA075862) Datasheet (External Link)
Vendor Page Anti RBFOX3 pAb (ATL-HPA075862) at Atlas Antibodies

Documents & Links for Anti RBFOX3 pAb (ATL-HPA075862)
Datasheet Anti RBFOX3 pAb (ATL-HPA075862) Datasheet (External Link)
Vendor Page Anti RBFOX3 pAb (ATL-HPA075862)