Anti RBFOX3 pAb (ATL-HPA075862)

Atlas Antibodies

SKU: ATL-HPA075862-25

• 
• 

Protein Description: RNA binding fox-1 homolog 3
Gene Name: RBFOX3
Alternative Gene Name: FOX-3, HRNBP3, NeuN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008658: 100%, ENSRNOG00000003386: 100%
Entrez Gene ID: 146713
Uniprot ID: A6NFN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS
• Gene Sequence: SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS
• Gene ID - Mouse: ENSMUSG00000008658
• Gene ID - Rat: ENSRNOG00000003386
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.