Anti RBBP4 pAb (ATL-HPA060710)

Atlas Antibodies

Catalog No.:
ATL-HPA060710-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: retinoblastoma binding protein 4
Gene Name: RBBP4
Alternative Gene Name: lin-53, NURF55, RbAp48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057236: 100%, ENSRNOG00000021492: 100%
Entrez Gene ID: 5928
Uniprot ID: Q09028
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT
Gene Sequence IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT
Gene ID - Mouse ENSMUSG00000057236
Gene ID - Rat ENSRNOG00000021492
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBBP4 pAb (ATL-HPA060710)
Datasheet Anti RBBP4 pAb (ATL-HPA060710) Datasheet (External Link)
Vendor Page Anti RBBP4 pAb (ATL-HPA060710) at Atlas Antibodies

Documents & Links for Anti RBBP4 pAb (ATL-HPA060710)
Datasheet Anti RBBP4 pAb (ATL-HPA060710) Datasheet (External Link)
Vendor Page Anti RBBP4 pAb (ATL-HPA060710)