Anti RBAK pAb (ATL-HPA071231)
Atlas Antibodies
- SKU:
- ATL-HPA071231-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RBAK
Alternative Gene Name: ZNF769
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061898: 71%, ENSRNOG00000001099: 71%
Entrez Gene ID: 57786
Uniprot ID: Q9NYW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EYNECMEALDNEAVFIAHKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPF |
Gene Sequence | EYNECMEALDNEAVFIAHKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPF |
Gene ID - Mouse | ENSMUSG00000061898 |
Gene ID - Rat | ENSRNOG00000001099 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RBAK pAb (ATL-HPA071231) | |
Datasheet | Anti RBAK pAb (ATL-HPA071231) Datasheet (External Link) |
Vendor Page | Anti RBAK pAb (ATL-HPA071231) at Atlas Antibodies |
Documents & Links for Anti RBAK pAb (ATL-HPA071231) | |
Datasheet | Anti RBAK pAb (ATL-HPA071231) Datasheet (External Link) |
Vendor Page | Anti RBAK pAb (ATL-HPA071231) |