Anti RBAK pAb (ATL-HPA071231)

Atlas Antibodies

Catalog No.:
ATL-HPA071231-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RB-associated KRAB zinc finger
Gene Name: RBAK
Alternative Gene Name: ZNF769
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061898: 71%, ENSRNOG00000001099: 71%
Entrez Gene ID: 57786
Uniprot ID: Q9NYW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYNECMEALDNEAVFIAHKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPF
Gene Sequence EYNECMEALDNEAVFIAHKRAYIGEKPYEWNDSGPDFIQMSNFNAYQRSQMEMKPF
Gene ID - Mouse ENSMUSG00000061898
Gene ID - Rat ENSRNOG00000001099
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RBAK pAb (ATL-HPA071231)
Datasheet Anti RBAK pAb (ATL-HPA071231) Datasheet (External Link)
Vendor Page Anti RBAK pAb (ATL-HPA071231) at Atlas Antibodies

Documents & Links for Anti RBAK pAb (ATL-HPA071231)
Datasheet Anti RBAK pAb (ATL-HPA071231) Datasheet (External Link)
Vendor Page Anti RBAK pAb (ATL-HPA071231)