Anti RAX2 pAb (ATL-HPA052533)

Atlas Antibodies

Catalog No.:
ATL-HPA052533-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: retina and anterior neural fold homeobox 2
Gene Name: RAX2
Alternative Gene Name: ARMD6, CORD11, MGC15631, RAXL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035522: 42%, ENSRNOG00000033520: 39%
Entrez Gene ID: 84839
Uniprot ID: Q96IS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLG
Gene Sequence ERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLG
Gene ID - Mouse ENSMUSG00000035522
Gene ID - Rat ENSRNOG00000033520
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAX2 pAb (ATL-HPA052533)
Datasheet Anti RAX2 pAb (ATL-HPA052533) Datasheet (External Link)
Vendor Page Anti RAX2 pAb (ATL-HPA052533) at Atlas Antibodies

Documents & Links for Anti RAX2 pAb (ATL-HPA052533)
Datasheet Anti RAX2 pAb (ATL-HPA052533) Datasheet (External Link)
Vendor Page Anti RAX2 pAb (ATL-HPA052533)