Anti RAX2 pAb (ATL-HPA052533)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052533-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RAX2
Alternative Gene Name: ARMD6, CORD11, MGC15631, RAXL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035522: 42%, ENSRNOG00000033520: 39%
Entrez Gene ID: 84839
Uniprot ID: Q96IS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLG |
Gene Sequence | ERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLG |
Gene ID - Mouse | ENSMUSG00000035522 |
Gene ID - Rat | ENSRNOG00000033520 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RAX2 pAb (ATL-HPA052533) | |
Datasheet | Anti RAX2 pAb (ATL-HPA052533) Datasheet (External Link) |
Vendor Page | Anti RAX2 pAb (ATL-HPA052533) at Atlas Antibodies |
Documents & Links for Anti RAX2 pAb (ATL-HPA052533) | |
Datasheet | Anti RAX2 pAb (ATL-HPA052533) Datasheet (External Link) |
Vendor Page | Anti RAX2 pAb (ATL-HPA052533) |