Anti RASSF7 pAb (ATL-HPA078015)

Atlas Antibodies

Catalog No.: ATL-HPA078015-25

Protein Description: Ras association (RalGDS/AF-6) domain family (N-terminal) member 7
Gene Name: RASSF7
Alternative Gene Name: C11orf13, HRAS1, HRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038618: 71%, ENSRNOG00000017109: 70%
Entrez Gene ID: 8045
Uniprot ID: Q02833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGP
• Gene Sequence: QATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGP
• Gene ID - Mouse: ENSMUSG00000038618
• Gene ID - Rat: ENSRNOG00000017109
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.