Anti RASSF5 pAb (ATL-HPA070480)

Atlas Antibodies

Catalog No.:
ATL-HPA070480-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ras association (RalGDS/AF-6) domain family member 5
Gene Name: RASSF5
Alternative Gene Name: Maxp1, NORE1, RAPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026430: 79%, ENSRNOG00000005342: 81%
Entrez Gene ID: 83593
Uniprot ID: Q8WWW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY
Gene Sequence EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY
Gene ID - Mouse ENSMUSG00000026430
Gene ID - Rat ENSRNOG00000005342
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASSF5 pAb (ATL-HPA070480)
Datasheet Anti RASSF5 pAb (ATL-HPA070480) Datasheet (External Link)
Vendor Page Anti RASSF5 pAb (ATL-HPA070480) at Atlas Antibodies

Documents & Links for Anti RASSF5 pAb (ATL-HPA070480)
Datasheet Anti RASSF5 pAb (ATL-HPA070480) Datasheet (External Link)
Vendor Page Anti RASSF5 pAb (ATL-HPA070480)