Anti RASSF5 pAb (ATL-HPA070480)

Atlas Antibodies

Catalog No.: ATL-HPA070480-25

Protein Description: Ras association (RalGDS/AF-6) domain family member 5
Gene Name: RASSF5
Alternative Gene Name: Maxp1, NORE1, RAPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026430: 79%, ENSRNOG00000005342: 81%
Entrez Gene ID: 83593
Uniprot ID: Q8WWW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY
• Gene Sequence: EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY
• Gene ID - Mouse: ENSMUSG00000026430
• Gene ID - Rat: ENSRNOG00000005342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.