Anti RASSF4 pAb (ATL-HPA077069)

Atlas Antibodies

SKU: ATL-HPA077069-25

• 

Protein Description: Ras association domain family member 4
Gene Name: RASSF4
Alternative Gene Name: AD037, MGC44914
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042129: 88%, ENSRNOG00000013526: 88%
Entrez Gene ID: 83937
Uniprot ID: Q9H2L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGV
• Gene Sequence: DGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGV
• Gene ID - Mouse: ENSMUSG00000042129
• Gene ID - Rat: ENSRNOG00000013526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.