Anti RASSF4 pAb (ATL-HPA077069)

Atlas Antibodies

Catalog No.:
ATL-HPA077069-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Ras association domain family member 4
Gene Name: RASSF4
Alternative Gene Name: AD037, MGC44914
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042129: 88%, ENSRNOG00000013526: 88%
Entrez Gene ID: 83937
Uniprot ID: Q9H2L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGV
Gene Sequence DGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGV
Gene ID - Mouse ENSMUSG00000042129
Gene ID - Rat ENSRNOG00000013526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASSF4 pAb (ATL-HPA077069)
Datasheet Anti RASSF4 pAb (ATL-HPA077069) Datasheet (External Link)
Vendor Page Anti RASSF4 pAb (ATL-HPA077069) at Atlas Antibodies

Documents & Links for Anti RASSF4 pAb (ATL-HPA077069)
Datasheet Anti RASSF4 pAb (ATL-HPA077069) Datasheet (External Link)
Vendor Page Anti RASSF4 pAb (ATL-HPA077069)