Anti RASSF2 pAb (ATL-HPA051200)

Atlas Antibodies

Catalog No.: ATL-HPA051200-25

Protein Description: Ras association (RalGDS/AF-6) domain family member 2
Gene Name: RASSF2
Alternative Gene Name: CENP-34, KIAA0168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027339: 88%, ENSRNOG00000021261: 88%
Entrez Gene ID: 9770
Uniprot ID: P50749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHR
• Gene Sequence: QMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHR
• Gene ID - Mouse: ENSMUSG00000027339
• Gene ID - Rat: ENSRNOG00000021261
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.