Anti RASSF2 pAb (ATL-HPA051200)

Atlas Antibodies

Catalog No.:
ATL-HPA051200-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Ras association (RalGDS/AF-6) domain family member 2
Gene Name: RASSF2
Alternative Gene Name: CENP-34, KIAA0168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027339: 88%, ENSRNOG00000021261: 88%
Entrez Gene ID: 9770
Uniprot ID: P50749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHR
Gene Sequence QMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHR
Gene ID - Mouse ENSMUSG00000027339
Gene ID - Rat ENSRNOG00000021261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASSF2 pAb (ATL-HPA051200)
Datasheet Anti RASSF2 pAb (ATL-HPA051200) Datasheet (External Link)
Vendor Page Anti RASSF2 pAb (ATL-HPA051200) at Atlas Antibodies

Documents & Links for Anti RASSF2 pAb (ATL-HPA051200)
Datasheet Anti RASSF2 pAb (ATL-HPA051200) Datasheet (External Link)
Vendor Page Anti RASSF2 pAb (ATL-HPA051200)