Anti RASL11B pAb (ATL-HPA057803)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057803-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: RASL11B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049907: 93%, ENSRNOG00000002097: 93%
Entrez Gene ID: 65997
Uniprot ID: Q9BPW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQ |
| Gene Sequence | YERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQ |
| Gene ID - Mouse | ENSMUSG00000049907 |
| Gene ID - Rat | ENSRNOG00000002097 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RASL11B pAb (ATL-HPA057803) | |
| Datasheet | Anti RASL11B pAb (ATL-HPA057803) Datasheet (External Link) |
| Vendor Page | Anti RASL11B pAb (ATL-HPA057803) at Atlas Antibodies |
| Documents & Links for Anti RASL11B pAb (ATL-HPA057803) | |
| Datasheet | Anti RASL11B pAb (ATL-HPA057803) Datasheet (External Link) |
| Vendor Page | Anti RASL11B pAb (ATL-HPA057803) |