Anti RASL11B pAb (ATL-HPA057803)

Atlas Antibodies

Catalog No.:
ATL-HPA057803-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAS-like, family 11, member B
Gene Name: RASL11B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049907: 93%, ENSRNOG00000002097: 93%
Entrez Gene ID: 65997
Uniprot ID: Q9BPW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQ
Gene Sequence YERNAGNLYTRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQ
Gene ID - Mouse ENSMUSG00000049907
Gene ID - Rat ENSRNOG00000002097
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASL11B pAb (ATL-HPA057803)
Datasheet Anti RASL11B pAb (ATL-HPA057803) Datasheet (External Link)
Vendor Page Anti RASL11B pAb (ATL-HPA057803) at Atlas Antibodies

Documents & Links for Anti RASL11B pAb (ATL-HPA057803)
Datasheet Anti RASL11B pAb (ATL-HPA057803) Datasheet (External Link)
Vendor Page Anti RASL11B pAb (ATL-HPA057803)