Anti RASL11A pAb (ATL-HPA053296)

Atlas Antibodies

Catalog No.:
ATL-HPA053296-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAS-like, family 11, member A
Gene Name: RASL11A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029641: 90%, ENSRNOG00000000956: 92%
Entrez Gene ID: 387496
Uniprot ID: Q6T310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQH
Gene Sequence YLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSENYEDVCDVFQH
Gene ID - Mouse ENSMUSG00000029641
Gene ID - Rat ENSRNOG00000000956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASL11A pAb (ATL-HPA053296)
Datasheet Anti RASL11A pAb (ATL-HPA053296) Datasheet (External Link)
Vendor Page Anti RASL11A pAb (ATL-HPA053296) at Atlas Antibodies

Documents & Links for Anti RASL11A pAb (ATL-HPA053296)
Datasheet Anti RASL11A pAb (ATL-HPA053296) Datasheet (External Link)
Vendor Page Anti RASL11A pAb (ATL-HPA053296)