Anti RASL10B pAb (ATL-HPA057092)

Atlas Antibodies

Catalog No.:
ATL-HPA057092-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RAS-like, family 10, member B
Gene Name: RASL10B
Alternative Gene Name: RRP17, VTS58635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020684: 98%, ENSRNOG00000055765: 100%
Entrez Gene ID: 91608
Uniprot ID: Q96S79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
Gene Sequence KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
Gene ID - Mouse ENSMUSG00000020684
Gene ID - Rat ENSRNOG00000055765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASL10B pAb (ATL-HPA057092)
Datasheet Anti RASL10B pAb (ATL-HPA057092) Datasheet (External Link)
Vendor Page Anti RASL10B pAb (ATL-HPA057092) at Atlas Antibodies

Documents & Links for Anti RASL10B pAb (ATL-HPA057092)
Datasheet Anti RASL10B pAb (ATL-HPA057092) Datasheet (External Link)
Vendor Page Anti RASL10B pAb (ATL-HPA057092)