Anti RASL10B pAb (ATL-HPA057092)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057092-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RASL10B
Alternative Gene Name: RRP17, VTS58635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020684: 98%, ENSRNOG00000055765: 100%
Entrez Gene ID: 91608
Uniprot ID: Q96S79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN |
| Gene Sequence | KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN |
| Gene ID - Mouse | ENSMUSG00000020684 |
| Gene ID - Rat | ENSRNOG00000055765 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RASL10B pAb (ATL-HPA057092) | |
| Datasheet | Anti RASL10B pAb (ATL-HPA057092) Datasheet (External Link) |
| Vendor Page | Anti RASL10B pAb (ATL-HPA057092) at Atlas Antibodies |
| Documents & Links for Anti RASL10B pAb (ATL-HPA057092) | |
| Datasheet | Anti RASL10B pAb (ATL-HPA057092) Datasheet (External Link) |
| Vendor Page | Anti RASL10B pAb (ATL-HPA057092) |