Anti RASL10B pAb (ATL-HPA046842 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046842-25

• 

Protein Description: RAS-like, family 10, member B
Gene Name: RASL10B
Alternative Gene Name: RRP17, VTS58635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020684: 98%, ENSRNOG00000055765: 98%
Entrez Gene ID: 91608
Uniprot ID: Q96S79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDL
• Gene Sequence: NTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDL
• Gene ID - Mouse: ENSMUSG00000020684
• Gene ID - Rat: ENSRNOG00000055765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RASL10B pAb (ATL-HPA046842 w/enhanced validation) – 1 Found

Inoue, A; Okamoto, K; Fujino, Y; Nakagawa, T; Muguruma, N; Sannomiya, K; Mitsui, Y; Takaoka, T; Kitamura, S; Miyamoto, H; Okahisa, T; Fujimori, T; Imoto, I; Takayama, T. B-RAF mutation and accumulated gene methylation in aberrant crypt foci (ACF), sessile serrated adenoma/polyp (SSA/P) and cancer in SSA/P. British Journal Of Cancer. 2015;112(2):403-12.