Anti RASL10A pAb (ATL-HPA056169)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056169-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RASL10A
Alternative Gene Name: RRP22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034209: 95%, ENSRNOG00000008951: 98%
Entrez Gene ID: 10633
Uniprot ID: Q92737
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM |
| Gene Sequence | AKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM |
| Gene ID - Mouse | ENSMUSG00000034209 |
| Gene ID - Rat | ENSRNOG00000008951 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RASL10A pAb (ATL-HPA056169) | |
| Datasheet | Anti RASL10A pAb (ATL-HPA056169) Datasheet (External Link) |
| Vendor Page | Anti RASL10A pAb (ATL-HPA056169) at Atlas Antibodies |
| Documents & Links for Anti RASL10A pAb (ATL-HPA056169) | |
| Datasheet | Anti RASL10A pAb (ATL-HPA056169) Datasheet (External Link) |
| Vendor Page | Anti RASL10A pAb (ATL-HPA056169) |