Anti RASL10A pAb (ATL-HPA056169)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056169-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RASL10A
Alternative Gene Name: RRP22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034209: 95%, ENSRNOG00000008951: 98%
Entrez Gene ID: 10633
Uniprot ID: Q92737
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM |
Gene Sequence | AKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM |
Gene ID - Mouse | ENSMUSG00000034209 |
Gene ID - Rat | ENSRNOG00000008951 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RASL10A pAb (ATL-HPA056169) | |
Datasheet | Anti RASL10A pAb (ATL-HPA056169) Datasheet (External Link) |
Vendor Page | Anti RASL10A pAb (ATL-HPA056169) at Atlas Antibodies |
Documents & Links for Anti RASL10A pAb (ATL-HPA056169) | |
Datasheet | Anti RASL10A pAb (ATL-HPA056169) Datasheet (External Link) |
Vendor Page | Anti RASL10A pAb (ATL-HPA056169) |