Anti RASIP1 pAb (ATL-HPA077251)

Atlas Antibodies

Catalog No.:
ATL-HPA077251-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ras interacting protein 1
Gene Name: RASIP1
Alternative Gene Name: FLJ20401, RAIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044562: 97%, ENSRNOG00000021004: 97%
Entrez Gene ID: 54922
Uniprot ID: Q5U651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CNDLELCDEAMALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRP
Gene Sequence CNDLELCDEAMALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRP
Gene ID - Mouse ENSMUSG00000044562
Gene ID - Rat ENSRNOG00000021004
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASIP1 pAb (ATL-HPA077251)
Datasheet Anti RASIP1 pAb (ATL-HPA077251) Datasheet (External Link)
Vendor Page Anti RASIP1 pAb (ATL-HPA077251) at Atlas Antibodies

Documents & Links for Anti RASIP1 pAb (ATL-HPA077251)
Datasheet Anti RASIP1 pAb (ATL-HPA077251) Datasheet (External Link)
Vendor Page Anti RASIP1 pAb (ATL-HPA077251)