Anti RASGRP2 pAb (ATL-HPA015667)

Atlas Antibodies

Catalog No.:
ATL-HPA015667-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Gene Name: RASGRP2
Alternative Gene Name: CALDAG-GEFI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106685: 97%, ENSRNOG00000021098: 97%
Entrez Gene ID: 10235
Uniprot ID: Q7LDG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPV
Gene Sequence DDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPV
Gene ID - Mouse ENSMUSG00000106685
Gene ID - Rat ENSRNOG00000021098
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASGRP2 pAb (ATL-HPA015667)
Datasheet Anti RASGRP2 pAb (ATL-HPA015667) Datasheet (External Link)
Vendor Page Anti RASGRP2 pAb (ATL-HPA015667) at Atlas Antibodies

Documents & Links for Anti RASGRP2 pAb (ATL-HPA015667)
Datasheet Anti RASGRP2 pAb (ATL-HPA015667) Datasheet (External Link)
Vendor Page Anti RASGRP2 pAb (ATL-HPA015667)
Citations for Anti RASGRP2 pAb (ATL-HPA015667) – 1 Found
Andersson, Sandra; Nilsson, Kenneth; Fagerberg, Linn; Hallström, Björn M; Sundström, Christer; Danielsson, Angelika; Edlund, Karolina; Uhlen, Mathias; Asplund, Anna. The transcriptomic and proteomic landscapes of bone marrow and secondary lymphoid tissues. Plos One. 9(12):e115911.  PubMed