Anti RASD1 pAb (ATL-HPA047896 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA047896-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAS, dexamethasone-induced 1
Gene Name: RASD1
Alternative Gene Name: AGS1, DEXRAS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049892: 98%, ENSRNOG00000003348: 98%
Entrez Gene ID: 51655
Uniprot ID: Q9Y272
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFE
Gene Sequence TKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFE
Gene ID - Mouse ENSMUSG00000049892
Gene ID - Rat ENSRNOG00000003348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASD1 pAb (ATL-HPA047896 w/enhanced validation)
Datasheet Anti RASD1 pAb (ATL-HPA047896 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RASD1 pAb (ATL-HPA047896 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RASD1 pAb (ATL-HPA047896 w/enhanced validation)
Datasheet Anti RASD1 pAb (ATL-HPA047896 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RASD1 pAb (ATL-HPA047896 w/enhanced validation)