Anti RASAL2 pAb (ATL-HPA020453)

Atlas Antibodies

Catalog No.:
ATL-HPA020453-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAS protein activator like 2
Gene Name: RASAL2
Alternative Gene Name: nGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070565: 95%, ENSRNOG00000004917: 97%
Entrez Gene ID: 9462
Uniprot ID: Q9UJF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT
Gene Sequence LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT
Gene ID - Mouse ENSMUSG00000070565
Gene ID - Rat ENSRNOG00000004917
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASAL2 pAb (ATL-HPA020453)
Datasheet Anti RASAL2 pAb (ATL-HPA020453) Datasheet (External Link)
Vendor Page Anti RASAL2 pAb (ATL-HPA020453) at Atlas Antibodies

Documents & Links for Anti RASAL2 pAb (ATL-HPA020453)
Datasheet Anti RASAL2 pAb (ATL-HPA020453) Datasheet (External Link)
Vendor Page Anti RASAL2 pAb (ATL-HPA020453)