Anti RASAL2 pAb (ATL-HPA020453)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020453-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RASAL2
Alternative Gene Name: nGAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070565: 95%, ENSRNOG00000004917: 97%
Entrez Gene ID: 9462
Uniprot ID: Q9UJF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT |
| Gene Sequence | LSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFEDPT |
| Gene ID - Mouse | ENSMUSG00000070565 |
| Gene ID - Rat | ENSRNOG00000004917 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RASAL2 pAb (ATL-HPA020453) | |
| Datasheet | Anti RASAL2 pAb (ATL-HPA020453) Datasheet (External Link) |
| Vendor Page | Anti RASAL2 pAb (ATL-HPA020453) at Atlas Antibodies |
| Documents & Links for Anti RASAL2 pAb (ATL-HPA020453) | |
| Datasheet | Anti RASAL2 pAb (ATL-HPA020453) Datasheet (External Link) |
| Vendor Page | Anti RASAL2 pAb (ATL-HPA020453) |