Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA064556-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: RAS p21 protein activator (GTPase activating protein) 1
Gene Name: RASA1
Alternative Gene Name: CM-AVM, GAP, p120GAP, p120RASGAP, RASA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021549: 99%, ENSRNOG00000029185: 99%
Entrez Gene ID: 5921
Uniprot ID: P20936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
Gene Sequence AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
Gene ID - Mouse ENSMUSG00000021549
Gene ID - Rat ENSRNOG00000029185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation)
Datasheet Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation)
Datasheet Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation)