Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA064556-25

• 

Protein Description: RAS p21 protein activator (GTPase activating protein) 1
Gene Name: RASA1
Alternative Gene Name: CM-AVM, GAP, p120GAP, p120RASGAP, RASA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021549: 99%, ENSRNOG00000029185: 99%
Entrez Gene ID: 5921
Uniprot ID: P20936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
• Gene Sequence: AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
• Gene ID - Mouse: ENSMUSG00000021549
• Gene ID - Rat: ENSRNOG00000029185
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.