Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064556-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: RASA1
Alternative Gene Name: CM-AVM, GAP, p120GAP, p120RASGAP, RASA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021549: 99%, ENSRNOG00000029185: 99%
Entrez Gene ID: 5921
Uniprot ID: P20936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ |
Gene Sequence | AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ |
Gene ID - Mouse | ENSMUSG00000021549 |
Gene ID - Rat | ENSRNOG00000029185 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) | |
Datasheet | Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) | |
Datasheet | Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RASA1 pAb (ATL-HPA064556 w/enhanced validation) |