Anti RARS pAb (ATL-HPA004130)

Atlas Antibodies

Catalog No.:
ATL-HPA004130-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: arginyl-tRNA synthetase
Gene Name: RARS
Alternative Gene Name: DALRD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018848: 96%, ENSRNOG00000007739: 95%
Entrez Gene ID: 5917
Uniprot ID: P54136
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEI
Gene Sequence VVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEI
Gene ID - Mouse ENSMUSG00000018848
Gene ID - Rat ENSRNOG00000007739
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RARS pAb (ATL-HPA004130)
Datasheet Anti RARS pAb (ATL-HPA004130) Datasheet (External Link)
Vendor Page Anti RARS pAb (ATL-HPA004130) at Atlas Antibodies

Documents & Links for Anti RARS pAb (ATL-HPA004130)
Datasheet Anti RARS pAb (ATL-HPA004130) Datasheet (External Link)
Vendor Page Anti RARS pAb (ATL-HPA004130)