Anti RARS pAb (ATL-HPA004130)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004130-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RARS
Alternative Gene Name: DALRD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018848: 96%, ENSRNOG00000007739: 95%
Entrez Gene ID: 5917
Uniprot ID: P54136
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEI |
| Gene Sequence | VVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEKERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAARETKILLDHEKEWKLGRCILRFPEI |
| Gene ID - Mouse | ENSMUSG00000018848 |
| Gene ID - Rat | ENSRNOG00000007739 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RARS pAb (ATL-HPA004130) | |
| Datasheet | Anti RARS pAb (ATL-HPA004130) Datasheet (External Link) |
| Vendor Page | Anti RARS pAb (ATL-HPA004130) at Atlas Antibodies |
| Documents & Links for Anti RARS pAb (ATL-HPA004130) | |
| Datasheet | Anti RARS pAb (ATL-HPA004130) Datasheet (External Link) |
| Vendor Page | Anti RARS pAb (ATL-HPA004130) |