Anti RAPH1 pAb (ATL-HPA020027)

Atlas Antibodies

Catalog No.: ATL-HPA020027-25

Protein Description: Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
Gene Name: RAPH1
Alternative Gene Name: ALS2CR18, ALS2CR9, KIAA1681
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026014: 95%, ENSRNOG00000014722: 95%
Entrez Gene ID: 65059
Uniprot ID: Q70E73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISEQPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDMALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSR
• Gene Sequence: NPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISEQPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDMALPPPPPELLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSR
• Gene ID - Mouse: ENSMUSG00000026014
• Gene ID - Rat: ENSRNOG00000014722
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAPH1 pAb (ATL-HPA020027) – 2 Found

Schopfer, Lawrence M; Delacour, Hervé; Masson, Patrick; Leroy, Jacqueline; Krejci, Eric; Lockridge, Oksana. The C5 Variant of the Butyrylcholinesterase Tetramer Includes a Noncovalently Bound 60 kDa Lamellipodin Fragment. Molecules (Basel, Switzerland). 2017;22(7) 

Chan Wah Hak, Laura; Khan, Shaheen; Di Meglio, Ilaria; Law, Ah-Lai; Lucken-Ardjomande Häsler, Safa; Quintaneiro, Leonor M; Ferreira, Antonio P A; Krause, Matthias; McMahon, Harvey T; Boucrot, Emmanuel. FBP17 and CIP4 recruit SHIP2 and lamellipodin to prime the plasma membrane for fast endophilin-mediated endocytosis. Nature Cell Biology. 2018;20(9):1023-1031.