Anti RAPH1 pAb (ATL-HPA016744)

Atlas Antibodies

Catalog No.: ATL-HPA016744-25

Protein Description: Ras association (RalGDS/AF-6) and pleckstrin homology domains 1
Gene Name: RAPH1
Alternative Gene Name: ALS2CR18, ALS2CR9, KIAA1681
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026014: 97%, ENSRNOG00000014722: 97%
Entrez Gene ID: 65059
Uniprot ID: Q70E73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLN
• Gene Sequence: QLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQETNMANFSYRFSIYNLN
• Gene ID - Mouse: ENSMUSG00000026014
• Gene ID - Rat: ENSRNOG00000014722
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RAPH1 pAb (ATL-HPA016744) – 2 Found

Lin, Jamie S; Jeon, Jin Seok; Fan, Qingfeng; Wong, Hetty N; Palmer, Matthew B; Holzman, Lawrence B. ARF6 mediates nephrin tyrosine phosphorylation-induced podocyte cellular dynamics. Plos One. 12(9):e0184575. 

Dimchev, Georgi; Amiri, Behnam; Humphries, Ashley C; Schaks, Matthias; Dimchev, Vanessa; Stradal, Theresia E B; Faix, Jan; Krause, Matthias; Way, Michael; Falcke, Martin; Rottner, Klemens. Lamellipodin tunes cell migration by stabilizing protrusions and promoting adhesion formation. Journal Of Cell Science. 2020;133(7)