Anti RAPGEF5 pAb (ATL-HPA076772)

Atlas Antibodies

Catalog No.:
ATL-HPA076772-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: Rap guanine nucleotide exchange factor (GEF) 5
Gene Name: RAPGEF5
Alternative Gene Name: GFR, KIAA0277, MR-GEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041992: 95%, ENSRNOG00000005271: 95%
Entrez Gene ID: 9771
Uniprot ID: Q92565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLD
Gene Sequence DFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLD
Gene ID - Mouse ENSMUSG00000041992
Gene ID - Rat ENSRNOG00000005271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAPGEF5 pAb (ATL-HPA076772)
Datasheet Anti RAPGEF5 pAb (ATL-HPA076772) Datasheet (External Link)
Vendor Page Anti RAPGEF5 pAb (ATL-HPA076772) at Atlas Antibodies

Documents & Links for Anti RAPGEF5 pAb (ATL-HPA076772)
Datasheet Anti RAPGEF5 pAb (ATL-HPA076772) Datasheet (External Link)
Vendor Page Anti RAPGEF5 pAb (ATL-HPA076772)