Anti RAP1GAP2 pAb (ATL-HPA022896)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022896-100
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/85089/155118/atl-hpa022896_anti-rap1gap2-pab-atl-hpa022896_36751__17208.1681105637.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)")
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: RAP1GAP2
Alternative Gene Name: GARNL4, KIAA1039
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038807: 94%, ENSRNOG00000002652: 95%
Entrez Gene ID: 23108
Uniprot ID: Q684P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EDPENVGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGNLILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQIAKAFCDDAVGLRFNPVLYPKASQMIVSYDEH |
| Gene Sequence | EDPENVGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGNLILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQIAKAFCDDAVGLRFNPVLYPKASQMIVSYDEH |
| Gene ID - Mouse | ENSMUSG00000038807 |
| Gene ID - Rat | ENSRNOG00000002652 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RAP1GAP2 pAb (ATL-HPA022896) | |
| Datasheet | Anti RAP1GAP2 pAb (ATL-HPA022896) Datasheet (External Link) |
| Vendor Page | Anti RAP1GAP2 pAb (ATL-HPA022896) at Atlas Antibodies |
| Documents & Links for Anti RAP1GAP2 pAb (ATL-HPA022896) | |
| Datasheet | Anti RAP1GAP2 pAb (ATL-HPA022896) Datasheet (External Link) |
| Vendor Page | Anti RAP1GAP2 pAb (ATL-HPA022896) |
| Citations for Anti RAP1GAP2 pAb (ATL-HPA022896) – 1 Found |
| Jakobsen, Lis; Vanselow, Katja; Skogs, Marie; Toyoda, Yusuke; Lundberg, Emma; Poser, Ina; Falkenby, Lasse G; Bennetzen, Martin; Westendorf, Jens; Nigg, Erich A; Uhlen, Mathias; Hyman, Anthony A; Andersen, Jens S. Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. The Embo Journal. 2011;30(8):1520-35. PubMed |