Anti RANGRF pAb (ATL-HPA057888)

Atlas Antibodies

Catalog No.:
ATL-HPA057888-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: RAN guanine nucleotide release factor
Gene Name: RANGRF
Alternative Gene Name: HSPC165, HSPC236, MOG1, RANGNRF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032892: 87%, ENSRNOG00000004980: 87%
Entrez Gene ID: 29098
Uniprot ID: Q9HD47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VAKDVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDPNIFGP
Gene Sequence VAKDVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDPNIFGP
Gene ID - Mouse ENSMUSG00000032892
Gene ID - Rat ENSRNOG00000004980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RANGRF pAb (ATL-HPA057888)
Datasheet Anti RANGRF pAb (ATL-HPA057888) Datasheet (External Link)
Vendor Page Anti RANGRF pAb (ATL-HPA057888) at Atlas Antibodies

Documents & Links for Anti RANGRF pAb (ATL-HPA057888)
Datasheet Anti RANGRF pAb (ATL-HPA057888) Datasheet (External Link)
Vendor Page Anti RANGRF pAb (ATL-HPA057888)