Anti RANGRF pAb (ATL-HPA057888)

Atlas Antibodies

SKU: ATL-HPA057888-25

• 

Protein Description: RAN guanine nucleotide release factor
Gene Name: RANGRF
Alternative Gene Name: HSPC165, HSPC236, MOG1, RANGNRF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032892: 87%, ENSRNOG00000004980: 87%
Entrez Gene ID: 29098
Uniprot ID: Q9HD47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAKDVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDPNIFGP
• Gene Sequence: VAKDVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDPNIFGP
• Gene ID - Mouse: ENSMUSG00000032892
• Gene ID - Rat: ENSRNOG00000004980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.