Anti RANBP9 pAb (ATL-HPA076784)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076784-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: RANBP9
Alternative Gene Name: RanBPM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038546: 94%, ENSRNOG00000017951: 95%
Entrez Gene ID: 10048
Uniprot ID: Q96S59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTVMEVDSS |
| Gene Sequence | ELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTVMEVDSS |
| Gene ID - Mouse | ENSMUSG00000038546 |
| Gene ID - Rat | ENSRNOG00000017951 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RANBP9 pAb (ATL-HPA076784) | |
| Datasheet | Anti RANBP9 pAb (ATL-HPA076784) Datasheet (External Link) |
| Vendor Page | Anti RANBP9 pAb (ATL-HPA076784) at Atlas Antibodies |
| Documents & Links for Anti RANBP9 pAb (ATL-HPA076784) | |
| Datasheet | Anti RANBP9 pAb (ATL-HPA076784) Datasheet (External Link) |
| Vendor Page | Anti RANBP9 pAb (ATL-HPA076784) |