Anti RANBP9 pAb (ATL-HPA076784)

Atlas Antibodies

Catalog No.:
ATL-HPA076784-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: RAN binding protein 9
Gene Name: RANBP9
Alternative Gene Name: RanBPM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038546: 94%, ENSRNOG00000017951: 95%
Entrez Gene ID: 10048
Uniprot ID: Q96S59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTVMEVDSS
Gene Sequence ELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTVMEVDSS
Gene ID - Mouse ENSMUSG00000038546
Gene ID - Rat ENSRNOG00000017951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RANBP9 pAb (ATL-HPA076784)
Datasheet Anti RANBP9 pAb (ATL-HPA076784) Datasheet (External Link)
Vendor Page Anti RANBP9 pAb (ATL-HPA076784) at Atlas Antibodies

Documents & Links for Anti RANBP9 pAb (ATL-HPA076784)
Datasheet Anti RANBP9 pAb (ATL-HPA076784) Datasheet (External Link)
Vendor Page Anti RANBP9 pAb (ATL-HPA076784)