Anti RANBP9 pAb (ATL-HPA050007)

Atlas Antibodies

Catalog No.:
ATL-HPA050007-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: RAN binding protein 9
Gene Name: RANBP9
Alternative Gene Name: RanBPM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038546: 88%, ENSRNOG00000017951: 90%
Entrez Gene ID: 10048
Uniprot ID: Q96S59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVP
Gene Sequence YPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVP
Gene ID - Mouse ENSMUSG00000038546
Gene ID - Rat ENSRNOG00000017951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RANBP9 pAb (ATL-HPA050007)
Datasheet Anti RANBP9 pAb (ATL-HPA050007) Datasheet (External Link)
Vendor Page Anti RANBP9 pAb (ATL-HPA050007) at Atlas Antibodies

Documents & Links for Anti RANBP9 pAb (ATL-HPA050007)
Datasheet Anti RANBP9 pAb (ATL-HPA050007) Datasheet (External Link)
Vendor Page Anti RANBP9 pAb (ATL-HPA050007)
Citations for Anti RANBP9 pAb (ATL-HPA050007) – 2 Found
Tessari, Anna; Parbhoo, Kareesma; Pawlikowski, Meghan; Fassan, Matteo; Rulli, Eliana; Foray, Claudia; Fabbri, Alessandra; Embrione, Valerio; Ganzinelli, Monica; Capece, Marina; Campbell, Moray J; Broggini, Massimo; La Perle, Krista; Farina, Gabriella; Cole, Sara; Marabese, Mirko; Hernandez, Marianna; Amann, Joseph M; Pruneri, Giancarlo; Carbone, David P; Garassino, Marina C; Croce, Carlo M; Palmieri, Dario; Coppola, Vincenzo. RANBP9 affects cancer cells response to genotoxic stress and its overexpression is associated with worse response to platinum in NSCLC patients. Oncogene. 2018;37(50):6463-6476.  PubMed
Soliman, Shimaa H A; Stark, Aaron E; Gardner, Miranda L; Harshman, Sean W; Breece, Chelssie C; Amari, Foued; Orlacchio, Arturo; Chen, Min; Tessari, Anna; Martin, Jennifer A; Visone, Rosa; Freitas, Michael A; La Perle, Krista M D; Palmieri, Dario; Coppola, Vincenzo. Tagging enhances histochemical and biochemical detection of Ran Binding Protein 9 in vivo and reveals its interaction with Nucleolin. Scientific Reports. 2020;10(1):7138.  PubMed