Anti RANBP6 pAb (ATL-HPA052684)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052684-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: RANBP6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074909: 94%, ENSRNOG00000053859: 71%
Entrez Gene ID: 26953
Uniprot ID: O60518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSSGFEEVYPNLPADVQRDVKIELILAVKLETHA |
Gene Sequence | LSSGFEEVYPNLPADVQRDVKIELILAVKLETHA |
Gene ID - Mouse | ENSMUSG00000074909 |
Gene ID - Rat | ENSRNOG00000053859 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RANBP6 pAb (ATL-HPA052684) | |
Datasheet | Anti RANBP6 pAb (ATL-HPA052684) Datasheet (External Link) |
Vendor Page | Anti RANBP6 pAb (ATL-HPA052684) at Atlas Antibodies |
Documents & Links for Anti RANBP6 pAb (ATL-HPA052684) | |
Datasheet | Anti RANBP6 pAb (ATL-HPA052684) Datasheet (External Link) |
Vendor Page | Anti RANBP6 pAb (ATL-HPA052684) |