Anti RANBP6 pAb (ATL-HPA052684)

Atlas Antibodies

Catalog No.:
ATL-HPA052684-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RAN binding protein 6
Gene Name: RANBP6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074909: 94%, ENSRNOG00000053859: 71%
Entrez Gene ID: 26953
Uniprot ID: O60518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSSGFEEVYPNLPADVQRDVKIELILAVKLETHA
Gene Sequence LSSGFEEVYPNLPADVQRDVKIELILAVKLETHA
Gene ID - Mouse ENSMUSG00000074909
Gene ID - Rat ENSRNOG00000053859
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RANBP6 pAb (ATL-HPA052684)
Datasheet Anti RANBP6 pAb (ATL-HPA052684) Datasheet (External Link)
Vendor Page Anti RANBP6 pAb (ATL-HPA052684) at Atlas Antibodies

Documents & Links for Anti RANBP6 pAb (ATL-HPA052684)
Datasheet Anti RANBP6 pAb (ATL-HPA052684) Datasheet (External Link)
Vendor Page Anti RANBP6 pAb (ATL-HPA052684)