Anti RANBP3L pAb (ATL-HPA061526 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061526-25

• 
• 

Protein Description: RAN binding protein 3-like
Gene Name: RANBP3L
Alternative Gene Name: FLJ25422
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110746: 34%, ENSRNOG00000006965: 27%
Entrez Gene ID: 202151
Uniprot ID: Q86VV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSKHVIRPAILQLPQARSCAKVRKTFGHKALESCKTKEKTNNKISEGNSYLLSE
• Gene Sequence: ITDSQSQGVRKNNVFMTSALVQSSVDIKSAEQGPVKHSKHVIRPAILQLPQARSCAKVRKTFGHKALESCKTKEKTNNKISEGNSYLLSE
• Gene ID - Mouse: ENSMUSG00000110746
• Gene ID - Rat: ENSRNOG00000006965
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.