Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA065931-25
  • Immunohistochemistry analysis in human testis and kidney tissues using Anti-RANBP1 antibody. Corresponding RANBP1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RH-30 shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: RAN binding protein 1
Gene Name: RANBP1
Alternative Gene Name: HTF9A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099164: 93%, ENSRNOG00000001884: 90%
Entrez Gene ID: 5902
Uniprot ID: P43487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKDTHEDHDTSTENTDESNHDPQFEPIVSL
Gene Sequence AKDTHEDHDTSTENTDESNHDPQFEPIVSL
Gene ID - Mouse ENSMUSG00000099164
Gene ID - Rat ENSRNOG00000001884
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation)
Datasheet Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation)