Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA065931-25

Protein Description: RAN binding protein 1
Gene Name: RANBP1
Alternative Gene Name: HTF9A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099164: 93%, ENSRNOG00000001884: 90%
Entrez Gene ID: 5902
Uniprot ID: P43487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKDTHEDHDTSTENTDESNHDPQFEPIVSL
• Gene Sequence: AKDTHEDHDTSTENTDESNHDPQFEPIVSL
• Gene ID - Mouse: ENSMUSG00000099164
• Gene ID - Rat: ENSRNOG00000001884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.