Anti RAMP2 pAb (ATL-HPA052020)

Atlas Antibodies

Catalog No.: ATL-HPA052020-25

Protein Description: receptor (G protein-coupled) activity modifying protein 2
Gene Name: RAMP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001240: 55%, ENSRNOG00000020415: 56%
Entrez Gene ID: 10266
Uniprot ID: O60895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP
• Gene Sequence: PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP
• Gene ID - Mouse: ENSMUSG00000001240
• Gene ID - Rat: ENSRNOG00000020415
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.