Anti RAMP2 pAb (ATL-HPA052020)

Atlas Antibodies

Catalog No.:
ATL-HPA052020-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: receptor (G protein-coupled) activity modifying protein 2
Gene Name: RAMP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001240: 55%, ENSRNOG00000020415: 56%
Entrez Gene ID: 10266
Uniprot ID: O60895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP
Gene Sequence PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP
Gene ID - Mouse ENSMUSG00000001240
Gene ID - Rat ENSRNOG00000020415
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RAMP2 pAb (ATL-HPA052020)
Datasheet Anti RAMP2 pAb (ATL-HPA052020) Datasheet (External Link)
Vendor Page Anti RAMP2 pAb (ATL-HPA052020) at Atlas Antibodies

Documents & Links for Anti RAMP2 pAb (ATL-HPA052020)
Datasheet Anti RAMP2 pAb (ATL-HPA052020) Datasheet (External Link)
Vendor Page Anti RAMP2 pAb (ATL-HPA052020)