Anti RALYL pAb (ATL-HPA059112)

Atlas Antibodies

Catalog No.:
ATL-HPA059112-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: RALY RNA binding protein-like
Gene Name: RALYL
Alternative Gene Name: HNRPCL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039717: 91%, ENSRNOG00000011400: 89%
Entrez Gene ID: 138046
Uniprot ID: Q86SE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSD
Gene Sequence DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSD
Gene ID - Mouse ENSMUSG00000039717
Gene ID - Rat ENSRNOG00000011400
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RALYL pAb (ATL-HPA059112)
Datasheet Anti RALYL pAb (ATL-HPA059112) Datasheet (External Link)
Vendor Page Anti RALYL pAb (ATL-HPA059112) at Atlas Antibodies

Documents & Links for Anti RALYL pAb (ATL-HPA059112)
Datasheet Anti RALYL pAb (ATL-HPA059112) Datasheet (External Link)
Vendor Page Anti RALYL pAb (ATL-HPA059112)