Anti RALGPS2 pAb (ATL-HPA028328 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028328-100

Protein Description: Ral GEF with PH domain and SH3 binding motif 2
Gene Name: RALGPS2
Alternative Gene Name: FLJ10244, FLJ25604, KIAA0351
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026594: 87%, ENSRNOG00000004736: 94%
Entrez Gene ID: 55103
Uniprot ID: Q86X27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEDDNYKLSLKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGP
• Gene Sequence: VEDDNYKLSLKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGP
• Gene ID - Mouse: ENSMUSG00000026594
• Gene ID - Rat: ENSRNOG00000004736
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.